Chapter 2: Sequence Analysis and Machine Learning
This chapter covers Sequence Analysis and Machine Learning. You will learn Predict protein localization and Predict enzyme activity using Random Forest.
Practical Protein Function Prediction
Learning Objectives
- ✅ Execute BLAST searches to discover homologous proteins
- ✅ Extract physicochemical features from amino acid sequences
- ✅ Predict protein localization and function using machine learning models
- ✅ Predict enzyme activity using Random Forest and LightGBM
- ✅ Evaluate and improve model performance
Reading time : 25-30 min | Code examples : 9 | Exercises : 3
2.1 Sequence Alignment
What is Alignment
Sequence alignment is a technique for comparing two or more sequences to evaluate their similarity.
```mermaid
flowchart LR
A[Query Sequence] --> B[Alignment\nAlgorithm]
C[Database] --> B
B --> D[Homologous Sequences]
D --> E[Function Inference]
D --> F[Evolutionary Analysis]
style A fill:#e3f2fd
style B fill:#fff3e0
style C fill:#f3e5f5
style D fill:#e8f5e9
style E fill:#ffebee
style F fill:#fff9c4
```
Applications : - Function prediction of unknown proteins - Analysis of evolutionary relationships - Identification of important residues
BLAST Search
BLAST (Basic Local Alignment Search Tool) is the most widely used sequence similarity search tool.
Example 1: BLAST Search using Biopython
from Bio.Blast import NCBIWWW, NCBIXML
from Bio import SeqIO
# Query sequence (example: insulin)
query_sequence = """
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
"""
print("Running BLAST search...")
# Search on NCBI BLAST server
result_handle = NCBIWWW.qblast(
"blastp", # Protein BLAST
"nr", # non-redundant database
query_sequence,
hitlist_size=10 # Top 10 hits
)
# Save results to file
with open("blast_results.xml", "w") as out_handle:
out_handle.write(result_handle.read())
result_handle.close()
print("Search complete. Analyzing results...")
# Parse results
with open("blast_results.xml") as result_handle:
blast_records = NCBIXML.parse(result_handle)
for blast_record in blast_records:
print(f"\n=== BLAST Search Results ===")
print(f"Query length: {blast_record.query_length} aa")
print(f"Number of hits: {len(blast_record.alignments)}")
# Display top 5 hits
for alignment in blast_record.alignments[:5]:
for hsp in alignment.hsps:
print(f"\n--- Hit ---")
print(f"Sequence: {alignment.title[:60]}...")
print(f"E-value: {hsp.expect:.2e}")
print(f"Score: {hsp.score}")
print(f"Identity: {hsp.identities}/{hsp.align_length} "
f"({100*hsp.identities/hsp.align_length:.1f}%)")
print(f"Alignment:")
print(f"Query: {hsp.query[:60]}")
print(f" {hsp.match[:60]}")
print(f"Sbjct: {hsp.sbjct[:60]}")
Sample output :
=== BLAST Search Results ===
Query length: 110 aa
Number of hits: 50
--- Hit ---
Sequence: insulin [Homo sapiens]
E-value: 2.5e-75
Score: 229
Identity: 110/110 (100.0%)
Alignment:
Query: MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
Local vs Global Alignment
Global Alignment (Needleman-Wunsch) : - Compares entire sequences - Applied to sequences of similar length
Local Alignment (Smith-Waterman) : - Detects most similar subregions - Applied to sequences of different lengths (used by BLAST)
Example 2: Alignment with Biopython
from Bio import pairwise2
from Bio.pairwise2 import format_alignment
# Two sequences
seq1 = "ACDEFGHIKLMNPQRSTVWY"
seq2 = "ACDEFGHIKLQNPQRSTVWY" # 1 character different
# Global alignment
alignments = pairwise2.align.globalxx(seq1, seq2)
print("=== Global Alignment ===")
print(format_alignment(*alignments[0]))
# Local alignment
local_alignments = pairwise2.align.localxx(seq1, seq2)
print("\n=== Local Alignment ===")
print(format_alignment(*local_alignments[0]))
# Scoring: match +2, mismatch -1, gap -0.5
gap_penalty = -0.5
alignments_scored = pairwise2.align.globalms(
seq1, seq2,
match=2,
mismatch=-1,
open=-0.5,
extend=-0.1
)
print("\n=== Alignment with Scoring ===")
print(format_alignment(*alignments_scored[0]))
print(f"Score: {alignments_scored[0][2]:.1f}")
2.2 Feature Extraction from Sequences
Physicochemical Properties of Amino Acids
20 amino acids have different physicochemical properties:
| Property | Amino Acids |
|---|---|
| Hydrophobic | A, V, I, L, M, F, W, P |
| Hydrophilic (Polar) | S, T, N, Q, Y, C |
| Basic (Positively charged) | K, R, H |
| Acidic (Negatively charged) | D, E |
| Aromatic | F, Y, W |
Example 3: Calculating Amino Acid Composition
# Requirements:
# - Python 3.9+
# - numpy>=1.24.0, <2.0.0
from collections import Counter
import numpy as np
def calculate_aa_composition(sequence):
"""
Calculate amino acid composition
Returns:
--------
dict: Frequency (%) of each amino acid
"""
# Convert to uppercase
sequence = sequence.upper()
# 20 standard amino acids
standard_aa = "ACDEFGHIKLMNPQRSTVWY"
# Count
aa_count = Counter(sequence)
# Convert to frequency (%)
total = len(sequence)
composition = {aa: 100 * aa_count.get(aa, 0) / total
for aa in standard_aa}
return composition
# Test sequence
sequence = """
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFY
TPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSIC
SLYQLENYCN
"""
sequence = sequence.replace("\n", "").replace(" ", "")
comp = calculate_aa_composition(sequence)
print("=== Amino Acid Composition ===")
for aa in sorted(comp.keys(), key=lambda x: comp[x], reverse=True):
if comp[aa] > 0:
print(f"{aa}: {comp[aa]:.1f}%")
# Aggregation of physicochemical properties
hydrophobic = ["A", "V", "I", "L", "M", "F", "W", "P"]
charged = ["K", "R", "H", "D", "E"]
polar = ["S", "T", "N", "Q", "Y", "C"]
hydrophobic_pct = sum(comp[aa] for aa in hydrophobic)
charged_pct = sum(comp[aa] for aa in charged)
polar_pct = sum(comp[aa] for aa in polar)
print(f"\nHydrophobic amino acids: {hydrophobic_pct:.1f}%")
print(f"Charged amino acids: {charged_pct:.1f}%")
print(f"Polar amino acids: {polar_pct:.1f}%")
k-mer Representation
k-mer is a contiguous subsequence of length k (equivalent to n-grams in natural language processing).
Example 4: k-mer Feature Extraction
from collections import Counter
def extract_kmers(sequence, k=3):
"""
Extract k-mer features
Parameters:
-----------
sequence : str
Amino acid sequence
k : int
Length of k-mer
Returns:
--------
dict: Frequency of k-mers
"""
kmers = []
for i in range(len(sequence) - k + 1):
kmer = sequence[i:i+k]
kmers.append(kmer)
# Calculate frequency
kmer_counts = Counter(kmers)
total = len(kmers)
# Convert to frequency (%)
kmer_freq = {kmer: 100 * count / total
for kmer, count in kmer_counts.items()}
return kmer_freq
# Test
sequence = "ACDEFGHIKLMNPQRSTVWY" * 3
# 3-mer
kmers_3 = extract_kmers(sequence, k=3)
print("=== Top 10 3-mers ===")
for kmer, freq in sorted(kmers_3.items(),
key=lambda x: x[1],
reverse=True)[:10]:
print(f"{kmer}: {freq:.2f}%")
# Create feature vector
def create_kmer_vector(sequence, k=3):
"""
Create k-mer feature vector (for machine learning)
"""
# Generate all possible k-mers (size: 20^k)
# In practice, use only frequent k-mers
kmers = extract_kmers(sequence, k)
# Vectorization (frequency-based)
vector = list(kmers.values())
return vector
# Feature vector for machine learning
feature_vector = create_kmer_vector(sequence, k=2)
print(f"\nFeature vector dimension: {len(feature_vector)}")
Physicochemical Descriptors
Example 5: Calculating Hydrophobicity Profile
# Requirements:
# - Python 3.9+
# - matplotlib>=3.7.0
# - numpy>=1.24.0, <2.0.0
import matplotlib.pyplot as plt
import numpy as np
# Kyte-Doolittle hydrophobicity scale
hydrophobicity_scale = {
'A': 1.8, 'C': 2.5, 'D': -3.5, 'E': -3.5,
'F': 2.8, 'G': -0.4, 'H': -3.2, 'I': 4.5,
'K': -3.9, 'L': 3.8, 'M': 1.9, 'N': -3.5,
'P': -1.6, 'Q': -3.5, 'R': -4.5, 'S': -0.8,
'T': -0.7, 'V': 4.2, 'W': -0.9, 'Y': -1.3
}
def calculate_hydrophobicity_profile(sequence, window=9):
"""
Calculate hydrophobicity profile
Parameters:
-----------
sequence : str
Amino acid sequence
window : int
Window size for moving average
Returns:
--------
list: Hydrophobicity score at each position
"""
profile = []
for i in range(len(sequence) - window + 1):
segment = sequence[i:i+window]
# Average hydrophobicity within window
hydrophobicity = np.mean([
hydrophobicity_scale.get(aa, 0)
for aa in segment
])
profile.append(hydrophobicity)
return profile
# Test sequence
sequence = """
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFY
"""
sequence = sequence.replace("\n", "").replace(" ", "")
# Hydrophobicity profile
profile = calculate_hydrophobicity_profile(sequence, window=9)
# Visualization
plt.figure(figsize=(12, 5))
plt.plot(range(len(profile)), profile, linewidth=2)
plt.axhline(y=0, color='black', linestyle='--', alpha=0.5)
plt.xlabel('Position', fontsize=12)
plt.ylabel('Hydrophobicity Score', fontsize=12)
plt.title('Kyte-Doolittle Hydrophobicity Profile', fontsize=14)
plt.grid(alpha=0.3)
plt.tight_layout()
plt.savefig('hydrophobicity_profile.png', dpi=300)
plt.show()
# Predict transmembrane regions (high hydrophobicity regions)
threshold = 1.6 # Threshold for transmembrane regions
tm_regions = []
for i, score in enumerate(profile):
if score > threshold:
tm_regions.append(i)
if tm_regions:
print(f"Transmembrane region candidate: {min(tm_regions)}-{max(tm_regions)}")
else:
print("No transmembrane regions detected")
2.3 Function Prediction with Machine Learning
Protein Localization Prediction
Example 6: Subcellular Localization Prediction
# Requirements:
# - Python 3.9+
# - numpy>=1.24.0, <2.0.0
# - pandas>=2.0.0, <2.2.0
import numpy as np
import pandas as pd
from sklearn.ensemble import RandomForestClassifier
from sklearn.model_selection import train_test_split
from sklearn.metrics import classification_report, confusion_matrix
# Generate sample data (in practice, retrieve from databases)
def generate_sample_data(n_samples=500):
"""
Generate sample data (for demo)
"""
np.random.seed(42)
data = []
# Nuclear: High in basic amino acids
for _ in range(n_samples // 5):
features = {
'hydrophobic_pct': np.random.normal(30, 5),
'charged_pct': np.random.normal(35, 5), # High
'polar_pct': np.random.normal(25, 5),
'aromatic_pct': np.random.normal(10, 3),
'length': np.random.normal(300, 50),
'localization': 'Nuclear'
}
data.append(features)
# Cytoplasmic
for _ in range(n_samples // 5):
features = {
'hydrophobic_pct': np.random.normal(35, 5),
'charged_pct': np.random.normal(25, 5),
'polar_pct': np.random.normal(30, 5),
'aromatic_pct': np.random.normal(10, 3),
'length': np.random.normal(350, 60),
'localization': 'Cytoplasmic'
}
data.append(features)
# Membrane: High in hydrophobic amino acids
for _ in range(n_samples // 5):
features = {
'hydrophobic_pct': np.random.normal(50, 5), # High
'charged_pct': np.random.normal(15, 5),
'polar_pct': np.random.normal(25, 5),
'aromatic_pct': np.random.normal(10, 3),
'length': np.random.normal(280, 40),
'localization': 'Membrane'
}
data.append(features)
# Mitochondrial
for _ in range(n_samples // 5):
features = {
'hydrophobic_pct': np.random.normal(38, 5),
'charged_pct': np.random.normal(28, 5),
'polar_pct': np.random.normal(24, 5),
'aromatic_pct': np.random.normal(10, 3),
'length': np.random.normal(320, 55),
'localization': 'Mitochondrial'
}
data.append(features)
# Secreted
for _ in range(n_samples // 5):
features = {
'hydrophobic_pct': np.random.normal(32, 5),
'charged_pct': np.random.normal(22, 5),
'polar_pct': np.random.normal(36, 5), # High
'aromatic_pct': np.random.normal(10, 3),
'length': np.random.normal(250, 45),
'localization': 'Secreted'
}
data.append(features)
return pd.DataFrame(data)
# Generate data
df = generate_sample_data(n_samples=500)
print("=== Dataset Overview ===")
print(df.head())
print(f"\nLocalization distribution:")
print(df['localization'].value_counts())
# Separate features and labels
X = df.drop('localization', axis=1)
y = df['localization']
# Split into training and test data
X_train, X_test, y_train, y_test = train_test_split(
X, y, test_size=0.2, random_state=42, stratify=y
)
# Random Forest model
model = RandomForestClassifier(
n_estimators=100,
max_depth=10,
random_state=42
)
model.fit(X_train, y_train)
# Prediction
y_pred = model.predict(X_test)
# Evaluation
print("\n=== Evaluation Results ===")
print(classification_report(y_test, y_pred))
# Feature importance
feature_importance = pd.DataFrame({
'feature': X.columns,
'importance': model.feature_importances_
}).sort_values('importance', ascending=False)
print("\n=== Feature Importance ===")
print(feature_importance)
# Predict new protein
new_protein = {
'hydrophobic_pct': 48.0,
'charged_pct': 18.0,
'polar_pct': 24.0,
'aromatic_pct': 10.0,
'length': 290.0
}
prediction = model.predict([list(new_protein.values())])
print(f"\nPredicted localization for new protein: {prediction[0]}")
2.4 Case Study: Enzyme Activity Prediction
Data Collection and Preprocessing
Example 7: Preparing Enzyme Dataset
# Requirements:
# - Python 3.9+
# - numpy>=1.24.0, <2.0.0
# - pandas>=2.0.0, <2.2.0
import pandas as pd
import numpy as np
from sklearn.model_selection import train_test_split
from sklearn.preprocessing import StandardScaler
def extract_features_from_sequence(sequence):
"""
Extract features from sequence
"""
# Amino acid composition
aa_count = {aa: sequence.count(aa) for aa in "ACDEFGHIKLMNPQRSTVWY"}
aa_comp = {f"aa_{aa}": count / len(sequence)
for aa, count in aa_count.items()}
# Physicochemical properties
hydrophobic = sum(sequence.count(aa) for aa in "AVILMFWP")
charged = sum(sequence.count(aa) for aa in "KRHDE")
polar = sum(sequence.count(aa) for aa in "STNQYC")
features = {
**aa_comp,
'length': len(sequence),
'hydrophobic_pct': 100 * hydrophobic / len(sequence),
'charged_pct': 100 * charged / len(sequence),
'polar_pct': 100 * polar / len(sequence),
'molecular_weight': sum(
aa_count.get(aa, 0) * mw
for aa, mw in {
'A': 89, 'C': 121, 'D': 133, 'E': 147,
'F': 165, 'G': 75, 'H': 155, 'I': 131,
'K': 146, 'L': 131, 'M': 149, 'N': 132,
'P': 115, 'Q': 146, 'R': 174, 'S': 105,
'T': 119, 'V': 117, 'W': 204, 'Y': 181
}.items()
)
}
return features
# Sample data (in practice, retrieve from UniProt etc.)
enzyme_data = [
{
'sequence': "ACDEFGHIKLMNPQRSTVWY" * 10,
'activity': 8.5 # log(kcat/Km)
},
# In practice, hundreds to thousands of data points
]
print("Feature extraction demo:")
features = extract_features_from_sequence(enzyme_data[0]['sequence'])
print(f"Number of features: {len(features)}")
print(f"Sample features:")
for key, value in list(features.items())[:5]:
print(f" {key}: {value:.3f}")
Model Training and Evaluation
Example 8: Enzyme Activity Prediction with LightGBM
# Requirements:
# - Python 3.9+
# - lightgbm>=4.0.0
# - matplotlib>=3.7.0
# - numpy>=1.24.0, <2.0.0
# - pandas>=2.0.0, <2.2.0
"""
Example: Example 8: Enzyme Activity Prediction with LightGBM
Purpose: Demonstrate data visualization techniques
Target: Intermediate
Execution time: 30-60 seconds
Dependencies: None
"""
import numpy as np
import pandas as pd
import lightgbm as lgb
from sklearn.model_selection import cross_val_score
from sklearn.metrics import mean_absolute_error, r2_score
import matplotlib.pyplot as plt
# Generate sample data (in practice, from databases)
np.random.seed(42)
n_samples = 200
X = np.random.randn(n_samples, 25) # 25 features
# Activity depends on specific features
y = (2.0 * X[:, 0] + 1.5 * X[:, 1] - 1.0 * X[:, 2] +
np.random.randn(n_samples) * 0.5)
# Train/test split
X_train, X_test, y_train, y_test = train_test_split(
X, y, test_size=0.2, random_state=42
)
# LightGBM model
model = lgb.LGBMRegressor(
n_estimators=100,
learning_rate=0.1,
max_depth=5,
random_state=42
)
model.fit(X_train, y_train)
# Prediction
y_pred = model.predict(X_test)
# Evaluation
mae = mean_absolute_error(y_test, y_pred)
r2 = r2_score(y_test, y_pred)
print(f"=== Model Performance ===")
print(f"MAE: {mae:.3f}")
print(f"R²: {r2:.3f}")
# Visualization
plt.figure(figsize=(8, 6))
plt.scatter(y_test, y_pred, alpha=0.6)
plt.plot([y_test.min(), y_test.max()],
[y_test.min(), y_test.max()],
'r--', lw=2)
plt.xlabel('Observed (log(kcat/Km))', fontsize=12)
plt.ylabel('Predicted', fontsize=12)
plt.title(f'Enzyme Activity Prediction (R²={r2:.3f})', fontsize=14)
plt.grid(alpha=0.3)
plt.tight_layout()
plt.savefig('enzyme_activity_prediction.png', dpi=300)
plt.show()
# Cross-validation
cv_scores = cross_val_score(
model, X_train, y_train,
cv=5,
scoring='r2'
)
print(f"\nCV R²: {cv_scores.mean():.3f} ± "
f"{cv_scores.std():.3f}")
Hyperparameter Tuning
Example 9: Optimization with Optuna
# Requirements:
# - Python 3.9+
# - lightgbm>=4.0.0
# - optuna>=3.2.0
import optuna
import lightgbm as lgb
from sklearn.model_selection import cross_val_score
def objective(trial):
"""
Optuna objective function
"""
# Hyperparameter search space
params = {
'n_estimators': trial.suggest_int('n_estimators', 50, 200),
'learning_rate': trial.suggest_float(
'learning_rate', 0.01, 0.3
),
'max_depth': trial.suggest_int('max_depth', 3, 10),
'num_leaves': trial.suggest_int('num_leaves', 20, 100),
'min_child_samples': trial.suggest_int(
'min_child_samples', 5, 50
),
'random_state': 42
}
# Model
model = lgb.LGBMRegressor(**params)
# Cross-validation
scores = cross_val_score(
model, X_train, y_train,
cv=3,
scoring='r2'
)
return scores.mean()
# Optimization
study = optuna.create_study(direction='maximize')
study.optimize(objective, n_trials=50)
print(f"\n=== Optimization Results ===")
print(f"Best R²: {study.best_value:.3f}")
print(f"Best parameters:")
for key, value in study.best_params.items():
print(f" {key}: {value}")
# Retrain with best model
best_model = lgb.LGBMRegressor(**study.best_params)
best_model.fit(X_train, y_train)
y_pred_best = best_model.predict(X_test)
r2_best = r2_score(y_test, y_pred_best)
print(f"\nTest R² (after optimization): {r2_best:.3f}")
2.5 Chapter Summary
What We Learned
-
Sequence Alignment - Homologous sequence search using BLAST - Local vs Global Alignment
-
Feature Extraction - Amino acid composition - k-mer representation - Physicochemical descriptors (hydrophobicity, etc.)
-
Machine Learning - Localization prediction with Random Forest - Enzyme activity prediction with LightGBM - Hyperparameter tuning
Next Chapter
In Chapter 3, we will learn about Molecular Docking and Interaction Analysis.
Chapter 3: Molecular Docking and Interaction Analysis →
Data Licenses and Citations
Sequence Databases
1. NCBI (National Center for Biotechnology Information)
- License : Public Domain
- Citation : NCBI Resource Coordinators. (2018). “Database resources of the National Center for Biotechnology Information.” Nucleic Acids Research , 46(D1), D8-D13.
- BLAST : https://blast.ncbi.nlm.nih.gov/
- Usage : Protein sequence search, homology analysis
2. UniProt
- License : CC BY 4.0
- Citation : The UniProt Consortium. (2023). “UniProt: the Universal Protein Knowledgebase in 2023.” Nucleic Acids Research , 51(D1), D523-D531.
- Access : https://www.uniprot.org/
- Usage : Annotated sequence data, enzyme activity information
3. Pfam (Protein families database)
- License : CC0 1.0
- Citation : Mistry, J. et al. (2021). “Pfam: The protein families database in 2021.” Nucleic Acids Research , 49(D1), D412-D419.
- Access : https://pfam.xfam.org/
- Usage : Protein domains, functional classification
Library Licenses
| Library | Version | License | Usage |
|---|---|---|---|
| Biopython | 1.81+ | BSD-3-Clause | BLAST, sequence analysis |
| scikit-learn | 1.3+ | BSD-3-Clause | Machine learning |
| LightGBM | 4.0+ | MIT | Gradient boosting |
| Optuna | 3.3+ | MIT | Hyperparameter optimization |
Code Reproducibility
Random Seed Setting
# Requirements:
# - Python 3.9+
# - lightgbm>=4.0.0
# - numpy>=1.24.0, <2.0.0
"""
Example: Random Seed Setting
Purpose: Demonstrate core concepts and implementation patterns
Target: Advanced
Execution time: ~5 seconds
Dependencies: None
"""
# Fix all random numbers
import numpy as np
import random
SEED = 42
np.random.seed(SEED)
random.seed(SEED)
# scikit-learn
from sklearn.ensemble import RandomForestClassifier
model = RandomForestClassifier(random_state=SEED)
# LightGBM
import lightgbm as lgb
model = lgb.LGBMRegressor(random_state=SEED)
Ensuring BLAST Search Reproducibility
from Bio.Blast import NCBIWWW
from datetime import datetime
# Record timestamp
timestamp = datetime.now().strftime("%Y-%m-%d %H:%M:%S")
# Execute BLAST
result_handle = NCBIWWW.qblast(
"blastp",
"nr",
query_sequence,
hitlist_size=10
)
# Save results (reproducible)
filename = f"blast_results_{timestamp.replace(' ', '_')}.xml"
with open(filename, "w") as f:
f.write(result_handle.read())
print(f"BLAST results saved: {filename}")
Common Pitfalls and Solutions
1. Misinterpretation of BLAST E-value
Problem : Misunderstanding that all low E-values are significant
NG :
if hsp.expect < 0.05: # Confused with statistical significance
accept_hit()
OK :
# E-value threshold varies by application
if application == 'homology_search':
threshold = 1e-10 # Strict threshold
elif application == 'remote_homology':
threshold = 1e-3 # Loose threshold
if hsp.expect < threshold and hsp.identities/hsp.align_length > 0.3:
# Also consider sequence identity
accept_hit()
2. Gap Penalty Setting Error in Sequence Alignment
Problem : Using default values as-is
NG :
# Default values are not always optimal
alignments = pairwise2.align.globalxx(seq1, seq2)
OK :
# Adjust according to protein type
if protein_type == 'short_peptide':
gap_open = -10
gap_extend = -0.5
elif protein_type == 'structured':
gap_open = -5
gap_extend = -2
alignments = pairwise2.align.globalms(
seq1, seq2,
match=2,
mismatch=-1,
open=gap_open,
extend=gap_extend
)
3. Dimensionality Explosion in k-mer Representation
Problem : k value too large causing memory issues
NG :
k = 5 # 20^5 = 3,200,000 dimensions!
kmers = extract_kmers(sequence, k=k)
OK :
# k=2 or 3 is practical
k = 3 # 20^3 = 8,000 dimensions
kmers = extract_kmers(sequence, k=k)
# Or use only frequent k-mers
from collections import Counter
kmer_counts = Counter(kmers.keys())
top_kmers = [k for k, _ in kmer_counts.most_common(1000)]
4. Overfitting in Machine Learning Models
Problem : Overfitting to training data
NG :
model = RandomForestClassifier(
n_estimators=1000,
max_depth=None # Unlimited depth
)
OK :
# Set regularization parameters
model = RandomForestClassifier(
n_estimators=100,
max_depth=10,
min_samples_split=5,
min_samples_leaf=2,
random_state=42
)
# Validate with cross-validation
from sklearn.model_selection import cross_val_score
cv_scores = cross_val_score(model, X, y, cv=5)
print(f"CV accuracy: {cv_scores.mean():.3f} ± {cv_scores.std():.3f}")
5. Ignoring Sequence Length Differences
Problem : Directly comparing sequences of different lengths
NG :
# Comparing absolute values (different lengths)
if feature1 > feature2:
select_protein1()
OK :
# Normalize before comparison
feature1_norm = feature1 / len(sequence1)
feature2_norm = feature2 / len(sequence2)
if feature1_norm > feature2_norm:
select_protein1()
6. Imbalanced Dataset
Problem : Large difference in sample size between classes
NG :
# Training with imbalanced data
model.fit(X_train, y_train)
OK :
from sklearn.utils.class_weight import compute_class_weight
# Calculate class weights
classes = np.unique(y_train)
class_weights = compute_class_weight(
'balanced',
classes=classes,
y=y_train
)
# Weighted training
model = RandomForestClassifier(
class_weight=dict(zip(classes, class_weights)),
random_state=42
)
model.fit(X_train, y_train)
Quality Checklist
Data Acquisition Phase
- Sequences are correctly saved in FASTA format
- Decided on handling policy for non-standard amino acids (X, B, Z, etc.)
- Checked sequence length distribution (remove extremely short/long sequences)
- Removed duplicate sequences
BLAST Search Phase
- E-value threshold is appropriate for application (1e-3 to 1e-10)
- Query sequence length is sufficient (minimum 20 residues)
- Database selection is appropriate (nr, swissprot, etc.)
- Sufficient number of hits (minimum 3-5)
Feature Extraction Phase
- Amino acid composition sum equals 100%
- k-mer k value is appropriate (2-3)
- Hydrophobicity scale is standard (Kyte-Doolittle, etc.)
- No missing values in features
Machine Learning Phase
- Train/test split uses stratified sampling
- Cross-validation performed (k=5 or 10)
- Feature scaling implemented (StandardScaler, etc.)
- Multiple model performance metrics (Accuracy, F1, AUC, etc.)
Enzyme Activity Prediction Specific
- Activity value units are clear (kcat/Km, IC50, etc.)
- Measurement conditions (pH, temperature) are unified
- Outlier detection and removal
- Consideration of experimental error
References
-
Altschul, S. F. et al. (1990). “Basic local alignment search tool.” Journal of Molecular Biology , 215(3), 403-410.
-
Kyte, J. & Doolittle, R. F. (1982). “A simple method for displaying the hydropathic character of a protein.” Journal of Molecular Biology , 157(1), 105-132.